Product Number |
ARP37911_T100 |
Product Page |
www.avivasysbio.com/tsg101-antibody-middle-region-arp37911-t100.html |
Name |
TSG101 Antibody - middle region (ARP37911_T100) |
Protein Size (# AA) |
391 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
22088 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Tumor susceptibility gene 101 |
Alias Symbols |
CC2, AI255943 |
Peptide Sequence |
Synthetic peptide located within the following region: YMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Stefan,M., et al., (er) BMC Genomics 6, 157 (2005) |
Description of Target |
TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer. |
Protein Interactions |
Nr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TSG101 (ARP37911_T100) antibody |
Blocking Peptide |
For anti-TSG101 (ARP37911_T100) antibody is Catalog # AAP37911 (Previous Catalog # AAPP10091) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q61187 |
Protein Name |
Tumor susceptibility gene 101 protein |
Protein Accession # |
NP_068684 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_021884 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
TSG101 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 87%; Dog: 87%; Goat: 87%; Guinea Pig: 93%; Horse: 87%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-TSG101 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: NIH/3T3 cell lysate |
|
|