Product Number |
ARP37897_P050 |
Product Page |
www.avivasysbio.com/trp53-antibody-n-terminal-region-arp37897-p050.html |
Name |
Trp53 Antibody - N-terminal region (ARP37897_P050) |
Protein Size (# AA) |
390 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
22059 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transformation related protein 53 |
Alias Symbols |
p4, p5, bbl, bfy, bhy, p44, p53, Tp53 |
Peptide Sequence |
Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Trp53 is a protein found in elevated levels in a great variety of transformed cells. |
Protein Interactions |
PRKAA1; Rnf128; Ndn; Herc2; Rchy1; Rps26; Rpl11; Cdkn2a; Bcl2l1; Daxx; Mdm2; Wwox; Mapk8; Smyd1; Ubc; Twist1; Pten; Bard1; Ep300; Sumo1; Trp73; Trp63; Strm; Nqo1; Mif; Hspa1b; Hipk2; Axin1; Zbtb7c; Topors; Gsk3b; Foxp3; Huwe1; Park7; Ccng1; NUMB; Skil; Cu |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Trp53 (ARP37897_P050) antibody |
Blocking Peptide |
For anti-Trp53 (ARP37897_P050) antibody is Catalog # AAP37897 (Previous Catalog # AAPP20019) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q549C9 |
Protein Name |
Cellular tumor antigen p53 RuleBase RU003304 |
Protein Accession # |
NP_035770 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_011640 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Trp53 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 93% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-Trp53 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: SP2/0 cell lysate |
|
Image 2 | Mouse Pancreas
| Host: Mouse Target Name: TP53 Sample Tissue: Mouse Pancreas Antibody Dilution: 1ug/ml |
|
Image 3 | Mouse Pancreas
| Host: Rabbit Target Name: TP53 Sample Tissue: Mouse Pancreas Antibody Dilution: 1ug/ml |
|
Image 4 | Mouse
| WB Suggested Anti-TRP53 Antibody Positive Control: Lane 1: 40ug C57/B6 control mouse G.I.
Lane 2: 40ug C57/B6 mouse G.I. treated with Irinotecan
Lane 3: 40ug p53 KO HCT-116 cells
Lane 4: 40ug C57/B6 mouse treated with 15 Gy ionizing radiation Primary Antibody Dilution : 1:1000 Secondary Antibody : Goat anti-rabbit-HRP Secondry Antibody Dilution : 1:2500 Submitted by: Brian Leibowitz, University of Pittsburgh |
|