Trp53 Antibody - N-terminal region (ARP37897_P050)

Data Sheet
 
Product Number ARP37897_P050
Product Page www.avivasysbio.com/trp53-antibody-n-terminal-region-arp37897-p050.html
Name Trp53 Antibody - N-terminal region (ARP37897_P050)
Protein Size (# AA) 390 amino acids
Molecular Weight 43kDa
NCBI Gene Id 22059
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transformation related protein 53
Alias Symbols p4, p5, bbl, bfy, bhy, p44, p53, Tp53
Peptide Sequence Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Trp53 is a protein found in elevated levels in a great variety of transformed cells.
Protein Interactions PRKAA1; Rnf128; Ndn; Herc2; Rchy1; Rps26; Rpl11; Cdkn2a; Bcl2l1; Daxx; Mdm2; Wwox; Mapk8; Smyd1; Ubc; Twist1; Pten; Bard1; Ep300; Sumo1; Trp73; Trp63; Strm; Nqo1; Mif; Hspa1b; Hipk2; Axin1; Zbtb7c; Topors; Gsk3b; Foxp3; Huwe1; Park7; Ccng1; NUMB; Skil; Cu
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Trp53 (ARP37897_P050) antibody
Blocking Peptide For anti-Trp53 (ARP37897_P050) antibody is Catalog # AAP37897 (Previous Catalog # AAPP20019)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q549C9
Protein Name Cellular tumor antigen p53 RuleBase RU003304
Protein Accession # NP_035770
Purification Affinity Purified
Nucleotide Accession # NM_011640
Tested Species Reactivity Mouse
Gene Symbol Trp53
Predicted Species Reactivity Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 93%
Image 1
Mouse SP2/0
WB Suggested Anti-Trp53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
Image 2
Mouse Pancreas
Host: Mouse
Target Name: TP53
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
Image 3
Mouse Pancreas
Host: Rabbit
Target Name: TP53
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
Image 4
Mouse
WB Suggested Anti-TRP53 Antibody
Positive Control: Lane 1: 40ug C57/B6 control mouse G.I. Lane 2: 40ug C57/B6 mouse G.I. treated with Irinotecan Lane 3: 40ug p53 KO HCT-116 cells Lane 4: 40ug C57/B6 mouse treated with 15 Gy ionizing radiation
Primary Antibody Dilution : 1:1000
Secondary Antibody : Goat anti-rabbit-HRP
Secondry Antibody Dilution : 1:2500
Submitted by: Brian Leibowitz, University of Pittsburgh
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com