| Product Number |
ARP37892_T100 |
| Product Page |
www.avivasysbio.com/spic-antibody-n-terminal-region-arp37892-t100.html |
| Name |
SPIC Antibody - N-terminal region (ARP37892_T100) |
| Protein Size (# AA) |
242 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
20728 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Spi-C transcription factor (Spi-1/PU.1 related) |
| Alias Symbols |
P, Sp, Prf, Spi-C, C76795, AU019198 |
| Peptide Sequence |
Synthetic peptide located within the following region: MTCCIDQDSLGQTFQDAIDILIQQSAGESQYSSENRNYMAIINPYPHVRG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kosmider,O., et al., (2005) Cancer Cell 8 (6), 467-478 |
| Description of Target |
Spic represents a subgroup within the Ets protein family. It is a regulatory molecule during a specific phase of B lymphoid development |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SPIC (ARP37892_T100) antibody |
| Blocking Peptide |
For anti-SPIC (ARP37892_T100) antibody is Catalog # AAP37892 (Previous Catalog # AAPP20014) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SPIC |
| Uniprot ID |
Q6P3D7 |
| Protein Name |
Transcription factor Spi-C |
| Protein Accession # |
NP_035591 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_011461 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
SPIC |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-SPIC Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate |
|
|
