website statistics
Product Datasheet: ARP37883_P050 - HOXD3 antibody - C-terminal region (ARP37883_P050) - Aviva Systems Biology
 
HOXD3 antibody - C-terminal region (ARP37883_P050)
Data Sheet
 
Product Number ARP37883_P050
Product Page www.avivasysbio.com/hoxd3-antibody-c-terminal-region-arp37883-p050.html
Product Name HOXD3 antibody - C-terminal region (ARP37883_P050)
Size 100 ul
Gene Symbol HOXD3
Alias Symbols Hox-4.1, Hox-5.5
Protein Size (# AA) 417 amino acids
Molecular Weight 46kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 15434
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Homeobox D3
Description This is a rabbit polyclonal antibody against HOXD3. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: NLQGSPVYVGGNFVDSMAPTSGPVFNLGHLSHPSSASVDYSCAAQIPGNH
Target Reference Patterson,L.T. (2004) Dev. Dyn. 229 (4), 771-779
Description of Target Hoxd3 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Protein Interactions Csde1; Tle6; Cers2; Meox2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-HOXD3 (ARP37883_P050) antibody is Catalog # AAP37883 (Previous Catalog # AAPP10082)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse HOXD3
Complete computational species homology data Anti-HOXD3 (ARP37883_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HOXD3.
Swissprot Id P09027
Protein Name Homeobox protein Hox-D3
Protein Accession # NP_034598
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HOXD3.
Nucleotide Accession # NM_010468
Replacement Item This antibody may replace item sc-130378 from Santa Cruz Biotechnology.
Conjugation Options

ARP37883_P050-FITC Conjugated

ARP37883_P050-HRP Conjugated

ARP37883_P050-Biotin Conjugated

CB Replacement sc-130378; sc-28610
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human Spinal cord
WB Suggested Anti-HOXD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Spinal cord
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com