HOXD3 Antibody - C-terminal region (ARP37883_P050)

• Product Number: ARP37883_P050
• Name: HOXD3 Antibody - C-terminal region (ARP37883_P050)
• Protein Size (# AA): 417 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 15434
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Homeobox D3
• Alias Symbols: Hox-4., Hox-5., Hox-4.1, Hox-5.5
• Peptide Sequence: Synthetic peptide located within the following region: NLQGSPVYVGGNFVDSMAPTSGPVFNLGHLSHPSSASVDYSCAAQIPGNH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Patterson,L.T. (2004) Dev. Dyn. 229 (4), 771-779
• Description of Target: Hoxd3 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Protein Interactions: Csde1; Tle6; Cers2; Meox2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HOXD3 (ARP37883_P050) antibody is Catalog # AAP37883 (Previous Catalog # AAPP10082)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse HOXD3
• Uniprot ID: P09027
• Protein Name: Homeobox protein Hox-D3
• Protein Accession #: NP_034598
• Purification: Affinity Purified
• Nucleotide Accession #: NM_010468
• Tested Species Reactivity: Human
• Gene Symbol: HOXD3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: Human Spinal cord
  
  WB Suggested Anti-HOXD3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Spinal cord