| Product Number |
ARP37882_T100 |
| Product Page |
www.avivasysbio.com/hoxa3-antibody-n-terminal-region-arp37882-t100.html |
| Name |
HOXA3 Antibody - N-terminal region (ARP37882_T100) |
| Protein Size (# AA) |
443 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
15400 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Homeobox A3 |
| Alias Symbols |
Mo-1, Mo-10, Hox-1., Hox-1.5 |
| Peptide Sequence |
Synthetic peptide located within the following region: YDSSAIYGGYPYQAANGFAYNASQQPYAPSAALGTDGVEYHRPACSLQSP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,Z., et al., (2005) Development 132 (23), 5307-5315 |
| Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. The HOXA3 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation |
| Protein Interactions |
Sox10; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXA3 (ARP37882_T100) antibody |
| Blocking Peptide |
For anti-HOXA3 (ARP37882_T100) antibody is Catalog # AAP37882 (Previous Catalog # AAPP20006) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse HOXA3 |
| Uniprot ID |
P02831 |
| Protein Name |
Homeobox protein Hox-A3 |
| Protein Accession # |
NP_034582 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_010452 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
HOXA3 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 93% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-HOXA3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate |
|
|
