Product Number |
ARP37876_T100 |
Product Page |
www.avivasysbio.com/nr1i3-antibody-middle-region-arp37876-t100.html |
Name |
NR1I3 Antibody - middle region (ARP37876_T100) |
Protein Size (# AA) |
358 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
12355 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Nuclear receptor subfamily 1, group I, member 3 |
Alias Symbols |
C, CA, mC, CAR, MB67, Care2, ESTM3, ESTM32, AA209988, AI551208, CAR-beta |
Peptide Sequence |
Synthetic peptide located within the following region: KELVQILLGAHTRHVGPLFDQFVQFKPPAYLFMHHRPFQPRGPVLPLLTH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Briancon,N. (2006) EMBO J. 25 (6), 1253-1262 |
Description of Target |
NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses. |
Protein Interactions |
NCOR2; Ppp2r1a; Ppp2ca; Hsp90ab1; Psmc4; NR0B2; Ncoa1; Ncor1; Rxrg; NCOA6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NR1I3 (ARP37876_T100) antibody |
Blocking Peptide |
For anti-NR1I3 (ARP37876_T100) antibody is Catalog # AAP37876 (Previous Catalog # AAPP20001) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse NR1I3 |
Uniprot ID |
O35627 |
Protein Name |
Nuclear receptor subfamily 1 group I member 3 |
Protein Accession # |
NP_033933 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_009803 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
NR1I3 |
Predicted Species Reactivity |
Mouse, Rat, Cow, Dog, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 86%; Guinea Pig: 79%; Mouse: 93%; Rat: 93% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-NR1I3 Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: NIH/3T3 cell lysate |
|