| Product Number |
ARP37870_T100 |
| Product Page |
www.avivasysbio.com/relb-antibody-n-terminal-region-arp37870-t100.html |
| Name |
RELB Antibody - N-terminal region (ARP37870_T100) |
| Protein Size (# AA) |
558 amino acids |
| Molecular Weight |
61kDa |
| NCBI Gene Id |
19698 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Avian reticuloendotheliosis viral (v-rel) oncogene related B |
| Alias Symbols |
sh, shep |
| Peptide Sequence |
Synthetic peptide located within the following region: MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Phan,H.H., et al., (2006) Gene 371 (1), 121-129 |
| Description of Target |
RelB is a member of the Rel/nuclear factor (NF)-kappa B family of transcription factors, defects in RelB affects antigen presenting cells and the formation of lymphoid organs. Targeted disruption of the Rel/NF-kappaB family members NF-kappaB2, encoding p100/p52, and RelB in mice results in anatomical defects of secondary lymphoid tissues. |
| Protein Interactions |
Nanog; Nfkb2; Nfkb1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RELB (ARP37870_T100) antibody |
| Blocking Peptide |
For anti-RELB (ARP37870_T100) antibody is Catalog # AAP37870 (Previous Catalog # AAPP09993) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RELB |
| Uniprot ID |
Q04863 |
| Protein Name |
Transcription factor RelB |
| Protein Accession # |
NP_033072 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_009046 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
RELB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Human: 93%; Mouse: 100%; Rat: 86% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-RELB Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate |
|
| Image 2 | Mouse Spleen
 | Host: Rabbit
Target Name: RELB
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml |
|
| Image 3 | Mouse Spleen
 | Host: Mouse
Target Name: RELB
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml |
|
