Foxj1 Antibody - middle region (ARP37855_P050)

Data Sheet
 
Product Number ARP37855_P050
Product Page www.avivasysbio.com/foxj1-antibody-middle-region-arp37855-p050.html
Name Foxj1 Antibody - middle region (ARP37855_P050)
Protein Size (# AA) 421 amino acids
Molecular Weight 45kDa
NCBI Gene Id 15223
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Forkhead box J1
Alias Symbols Hfh4, HFH-4, FKHL-1, FKHL-13
Peptide Sequence Synthetic peptide located within the following region: YAERLLSGAFKKRRLPPVHIHPAFARQASQEPSAAPWGGPLTVNREAQQL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions Rfx2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Foxj1 (ARP37855_P050) antibody
Blocking Peptide For anti-Foxj1 (ARP37855_P050) antibody is Catalog # AAP37855 (Previous Catalog # AAPP09978)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID Q3US42
Protein Name Forkhead box protein J1
Protein Accession # NP_032266
Purification Affinity Purified
Nucleotide Accession # NM_008240
Tested Species Reactivity Mouse
Gene Symbol Foxj1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Image 1
Mouse Small Intestine
WB Suggested Anti-Foxj1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com