ZNF845 Antibody - middle region (ARP37829_P050)

Data Sheet
 
Product Number ARP37829_P050
Product Page www.avivasysbio.com/znf845-antibody-middle-region-arp37829-p050.html
Name ZNF845 Antibody - middle region (ARP37829_P050)
Protein Size (# AA) 1132 amino acids
Molecular Weight 125kDa
NCBI Gene Id 91664
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 845
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: YKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The exact function of LOC91664 remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF845 (ARP37829_P050) antibody
Blocking Peptide For anti-ZNF845 (ARP37829_P050) antibody is Catalog # AAP37829 (Previous Catalog # AAPP09059)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LOC91664
Uniprot ID Q96IR2
Protein Accession # XP_942705
Purification Affinity Purified
Nucleotide Accession # XM_937612
Tested Species Reactivity Human
Gene Symbol ZNF845
Predicted Species Reactivity Human, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rabbit: 77%
Image 1
Human HepG2
WB Suggested Anti-ZNF845 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com