website statistics
Product Datasheet: ARP37829_P050 - ZNF845 antibody - middle region (ARP37829_P050) - Aviva Systems Biology
 
ZNF845 antibody - middle region (ARP37829_P050)
Data Sheet
 
Product Number ARP37829_P050
Product Page www.avivasysbio.com/znf845-antibody-middle-region-arp37829-p050.html
Product Name ZNF845 antibody - middle region (ARP37829_P050)
Size 100 ul
Gene Symbol ZNF845
Alias Symbols -
Protein Size (# AA) 1132 amino acids
Molecular Weight 125kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 91664
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 845
Description This is a rabbit polyclonal antibody against LOC91664. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: YKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRL
Description of Target The exact function of LOC91664 remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZNF845 (ARP37829_P050) antibody is Catalog # AAP37829 (Previous Catalog # AAPP09059)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LOC91664
Complete computational species homology data Anti-ZNF845 (ARP37829_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF845.
Protein Accession # XP_942705
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF845.
Nucleotide Accession # XM_937612
Conjugation Options

ARP37829_P050-FITC Conjugated

ARP37829_P050-HRP Conjugated

ARP37829_P050-Biotin Conjugated

Species Reactivity Human, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rabbit: 77%
Image 1
Human HepG2
WB Suggested Anti-ZNF845 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com