Product Number |
ARP37829_P050 |
Product Page |
www.avivasysbio.com/znf845-antibody-middle-region-arp37829-p050.html |
Name |
ZNF845 Antibody - middle region (ARP37829_P050) |
Protein Size (# AA) |
1132 amino acids |
Molecular Weight |
125kDa |
NCBI Gene Id |
91664 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 845 |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: YKCNECGKTFGRNSALIIHKAIHTGEKPYKCNECGKAFSQKSSLTCHLRL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The exact function of LOC91664 remains unknown. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF845 (ARP37829_P050) antibody |
Blocking Peptide |
For anti-ZNF845 (ARP37829_P050) antibody is Catalog # AAP37829 (Previous Catalog # AAPP09059) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC91664 |
Uniprot ID |
Q96IR2 |
Protein Accession # |
XP_942705 |
Purification |
Affinity Purified |
Nucleotide Accession # |
XM_937612 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF845 |
Predicted Species Reactivity |
Human, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rabbit: 77% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF845 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|