| Product Number |
ARP37766_T100 |
| Product Page |
www.avivasysbio.com/znf12-antibody-n-terminal-region-arp37766-t100.html |
| Name |
ZNF12 Antibody - N-terminal region (ARP37766_T100) |
| Protein Size (# AA) |
697 amino acids |
| Molecular Weight |
77kDa |
| NCBI Gene Id |
7559 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 12 |
| Alias Symbols |
KOX3, HZF11, GIOT-3, ZNF325 |
| Peptide Sequence |
Synthetic peptide located within the following region: ADECSGCGKSLLHIKLEKTHPGDQAYEFNQNGEPYTLNEESLYQKIRILE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Abrink,M., et al., (1995) DNA Cell Biol. 14 (2), 125-136 |
| Description of Target |
Two members of the human zinc finger Kruppel family, ZNF 12 (KOX 3) and ZNF 26 (KOX 20), have been localized by somatic cell hybrid analysis and in situ chromosomal hybridization. The presence of individual human zinc finger genes in mouse-human hybrid DNAs was correlated with the presence of specific human chromosomes or regions of chromosomes in the corresponding cell hybrids. Analysis of such mouse-human hybrid DNAs assigned the ZNF 12 (KOX 3) gene to chromosome region 7p. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF12 (ARP37766_T100) antibody |
| Blocking Peptide |
For anti-ZNF12 (ARP37766_T100) antibody is Catalog # AAP37766 (Previous Catalog # AAPP08846) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF12 |
| Uniprot ID |
P17014 |
| Protein Name |
Zinc finger protein 12 |
| Sample Type Confirmation |
ZNF12 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_057349 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_016265 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF12 |
| Predicted Species Reactivity |
Human, Rat, Dog, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Horse: 79%; Human: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF12 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateZNF12 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
|
