| Product Number |
ARP37763_T100 |
| Product Page |
www.avivasysbio.com/zfp589-antibody-middle-region-arp37763-t100.html |
| Name |
ZFP589 Antibody - middle region (ARP37763_T100) |
| Protein Size (# AA) |
361 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
51385 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 589 |
| Alias Symbols |
SZF1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LEIQLSPAQNASSEEVDRISKRAETPGFGAVRFGECALAFNQKSNLFRQK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Liu,C., et al., (1999) Exp. Hematol. 27 (2), 313-325 |
| Description of Target |
The function of Anti-ZFP589 has not yet been determined. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF589 (ARP37763_T100) antibody |
| Blocking Peptide |
For anti-ZNF589 (ARP37763_T100) antibody is Catalog # AAP37763 (Previous Catalog # AAPP08843) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZFP589 |
| Uniprot ID |
Q9Y611 |
| Protein Name |
Zinc finger protein 589 |
| Protein Accession # |
AAD38880 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_016089 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF589 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZFP589 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
