| Product Number |
ARP37744_P050 |
| Product Page |
www.avivasysbio.com/ncoa4-antibody-n-terminal-region-arp37744-p050.html |
| Name |
Ncoa4 Antibody - N-terminal region (ARP37744_P050) |
| Protein Size (# AA) |
625 amino acids |
| Molecular Weight |
70kDa |
| NCBI Gene Id |
27057 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nuclear receptor coactivator 4 |
| Alias Symbols |
Rfg, ARA70 |
| Peptide Sequence |
Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Ncoa4 remains unknown. |
| Protein Interactions |
Ndn; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ncoa4 (ARP37744_P050) antibody |
| Blocking Peptide |
For anti-Ncoa4 (ARP37744_P050) antibody is Catalog # AAP37744 (Previous Catalog # AAPP23367) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Protein Accession # |
NP_001029160 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001033988 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Ncoa4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Ncoa4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Heart |
|
|
