LDB1 Antibody - middle region (ARP37731_P050)

Data Sheet
 
Product Number ARP37731_P050
Product Page www.avivasysbio.com/ldb1-antibody-middle-region-arp37731-p050.html
Name LDB1 Antibody - middle region (ARP37731_P050)
Protein Size (# AA) 375 amino acids
Molecular Weight 43kDa
NCBI Gene Id 8861
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name LIM domain binding 1
Alias Symbols NLI, CLIM2, LDB-1, CLIM-2
Peptide Sequence Synthetic peptide located within the following region: EPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Marini,M., et al., (2003) Int. J. Mol. Med. 12 (1), 79-82
Description of Target LDB1 is a transcriptional activator that associates with the LIM homeoproteins and coordinate transcription. LIM homeoproteins and LDBs are involved in a variety of developmental processes.
Protein Interactions LHX8; LHX6; SSBP3; LMO4; LMX1B; LMO2; LMO1; POLR1B; LSM7; IRAK3; UBC; PSMD10; PSMA1; TRIM33; ATXN1; RNF38; RNF6; rlim-a; RLIM; RB1; TAL1; LHX2; LMO3; SSBP4; SSBP2; TOLLIP; CTDSP1; LHX3; SSBP1; ISL1; LMX1A; ESR1; TCF3; SP1; CBFA2T3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LDB1 (ARP37731_P050) antibody
Blocking Peptide For anti-LDB1 (ARP37731_P050) antibody is Catalog # AAP37731 (Previous Catalog # AAPP08813)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LDB1
Uniprot ID Q86U70
Protein Name LIM domain-binding protein 1
Sample Type Confirmation

LDB1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_003884
Purification Affinity Purified
Nucleotide Accession # NM_003893
Tested Species Reactivity Human
Gene Symbol LDB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-LDB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateLDB1 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com