LDB1 Antibody - C-terminal region (ARP37730_P050)

Data Sheet
 
Product Number ARP37730_P050
Product Page www.avivasysbio.com/ldb1-antibody-c-terminal-region-arp37730-p050.html
Name LDB1 Antibody - C-terminal region (ARP37730_P050)
Protein Size (# AA) 375 amino acids
Molecular Weight 43kDa
NCBI Gene Id 8861
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name LIM domain binding 1
Alias Symbols NLI, CLIM2, LDB-1, CLIM-2
Peptide Sequence Synthetic peptide located within the following region: VVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Marini,M., (2003) Int. J. Mol. Med. 12 (1), 79-82
Description of Target LDB1 is a transcriptional activator that associates with the LIM homeoproteins and coordinate transcription. LIM homeoproteins and LDBs are involved in a variety of developmental processes.
Protein Interactions LHX8; LHX6; SSBP3; LMO4; LMX1B; LMO2; LMO1; POLR1B; LSM7; IRAK3; UBC; PSMD10; PSMA1; TRIM33; ATXN1; RNF38; RNF6; rlim-a; RLIM; RB1; TAL1; LHX2; LMO3; SSBP4; SSBP2; TOLLIP; CTDSP1; LHX3; SSBP1; ISL1; LMX1A; ESR1; TCF3; SP1; CBFA2T3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LDB1 (ARP37730_P050) antibody
Blocking Peptide For anti-LDB1 (ARP37730_P050) antibody is Catalog # AAP37730 (Previous Catalog # AAPP23364)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LDB1
Uniprot ID Q86U70-2
Protein Name LIM domain-binding protein 1
Protein Accession # NP_003884
Purification Affinity Purified
Nucleotide Accession # NM_003893
Tested Species Reactivity Human
Gene Symbol LDB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-LDB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com