SSX2 Antibody - C-terminal region (ARP37719_P050)

• Product Number: ARP37719_P050
• Name: SSX2 Antibody - C-terminal region (ARP37719_P050)
• Protein Size (# AA): 223 amino acids
• Molecular Weight: 25kDa
• NCBI Gene Id: 6757
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Synovial sarcoma, X breakpoint 2
• Alias Symbols: SSX, HD21, CT5.2, CT5.2A, HOM-MEL-40
• Peptide Sequence: Synthetic peptide located within the following region: HRWSSQNTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fernebro,J., et al., (2006) Int. J. Cancer 118 (5), 1165-1172
• Description of Target: SSX2 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene.The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Protein Interactions: KRT40; SSX2IP; RAB3IP; SYCE1; ZMIZ2; MAGEC2; AKAP9; ZBED1; TAX1BP1; BLZF1; SUZ12; EED; SMARCA5; TLE1; SMARCA2; HDAC2; HDAC1; EZH2; ATF2; RNF2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SSX2 (ARP37719_P050) antibody is Catalog # AAP37719 (Previous Catalog # AAPP08802)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SSX2
• Uniprot ID: Q16385-2
• Protein Name: Protein SSX2
• Publications:

  Jung, V. et al. Yeast-based identification of prostate tumor antigens provides an effective vaccine platform. Anticancer Res. 30, 895-902 (2010). 20393012

• Protein Accession #: NP_003138
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003147
• Tested Species Reactivity: Human
• Gene Symbol: SSX2
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Jurkat
  
  Host: Rabbit
  Target Name: SSX2
  Sample Tissue: Human Jurkat
  Antibody Dilution: 1.0ug/ml