DDX1 Antibody - C-terminal region (ARP37712_T100)

Data Sheet
 
Product Number ARP37712_T100
Product Page www.avivasysbio.com/ddx1-antibody-c-terminal-region-arp37712-t100.html
Name DDX1 Antibody - C-terminal region (ARP37712_T100)
Protein Size (# AA) 740 amino acids
Molecular Weight 81kDa
NCBI Gene Id 1653
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DEAD (Asp-Glu-Ala-Asp) box helicase 1
Alias Symbols DBP-RB, UKVH5d
Peptide Sequence Synthetic peptide located within the following region: SQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chen,H.C., et al., (2002) J. Biol. Chem. 277 (43), 40403-40409
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
Protein Interactions HUWE1; FUS; SUMO2; SUMO3; STAU1; UBC; SUMO1; NEDD8; Fbxl16; WWOX; ZBTB1; RPA3; RPA2; RPA1; rev; C14orf166; RTCB; RPL26L1; EIF3K; NELFB; EDC4; IGF2BP3; PDCD6; ABCF1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; YBX1; NMT1; HNRNPM; MRE11A; KRT18; ILF2; HN
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDX1 (ARP37712_T100) antibody
Blocking Peptide For anti-DDX1 (ARP37712_T100) antibody is Catalog # AAP37712 (Previous Catalog # AAPP09044)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DDX1
Uniprot ID Q92499
Protein Name ATP-dependent RNA helicase DDX1
Sample Type Confirmation

DDX1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_004930
Purification Protein A purified
Nucleotide Accession # NM_004939
Tested Species Reactivity Human
Gene Symbol DDX1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-DDX1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateDDX1 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com