ACCN5 Antibody - middle region (ARP37696_T100)

• Product Number: ARP37696_T100
• Name: ACCN5 Antibody - middle region (ARP37696_T100)
• Protein Size (# AA): 505 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 51802
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Acid-sensing (proton-gated) ion channel family member 5
• Alias Symbols: INAC, ACCN5, HINAC
• Peptide Sequence: Synthetic peptide located within the following region: FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Schaefer,L., et al., (2000) FEBS Lett. 471 (2-3), 205-210
• Description of Target: ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ASIC5 (ARP37696_T100) antibody is Catalog # AAP37696 (Previous Catalog # AAPP09030)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACCN5
• Uniprot ID: Q9NY37
• Protein Name: Acid-sensing ion channel 5
• Protein Accession #: NP_059115
• Purification: Protein A purified
• Nucleotide Accession #: NM_017419
• Tested Species Reactivity: Human
• Gene Symbol: ASIC5
• Predicted Species Reactivity: Human, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 79%; Human: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ACCN5 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate