| Product Number |
ARP37679_P050 |
| Product Page |
www.avivasysbio.com/kcnk5-antibody-c-terminal-region-arp37679-p050.html |
| Name |
KCNK5 Antibody - C-terminal region (ARP37679_P050) |
| Protein Size (# AA) |
499 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
8645 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Potassium channel, subfamily K, member 5 |
| Alias Symbols |
TASK2, K2p5.1, KCNK5b, TASK-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Rusznak,Z., et al., (2004) Cell. Mol. Life Sci. 61 (12), 1532-1542 |
| Description of Target |
KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport. |
| Protein Interactions |
FRAT1; APP; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KCNK5 (ARP37679_P050) antibody |
| Blocking Peptide |
For anti-KCNK5 (ARP37679_P050) antibody is Catalog # AAP37679 (Previous Catalog # AAPP09013) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK5 |
| Uniprot ID |
O95279 |
| Protein Name |
Potassium channel subfamily K member 5 |
| Protein Accession # |
NP_003731 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003740 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KCNK5 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 92%; Rat: 92% |
| Image 1 | Human HepG2
 | WB Suggested Anti-KCNK5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
