| Product Number |
ARP37678_T100 |
| Product Page |
www.avivasysbio.com/kcnab2-antibody-middle-region-arp37678-t100.html |
| Name |
KCNAB2 Antibody - middle region (ARP37678_T100) |
| Protein Size (# AA) |
367 amino acids |
| Molecular Weight |
40kDa |
| Subunit |
beta-2 |
| NCBI Gene Id |
8514 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Potassium voltage-gated channel, shaker-related subfamily, beta member 2 |
| Description |
|
| Alias Symbols |
AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2 |
| Peptide Sequence |
Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gu,C., (2003) Science 301 (5633), 646-649 |
| Description of Target |
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. |
| Protein Interactions |
KCNAB2; SIRT1; KCNA5; KCNA4; UBC; RPA3; RPA2; RPA1; ATXN1; Nedd4; NEDD4L; SLC39A2; SLC39A1; SQSTM1; CD4; KCNA2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KCNAB2 (ARP37678_T100) antibody |
| Blocking Peptide |
For anti-KCNAB2 (ARP37678_T100) antibody is Catalog # AAP37678 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2 |
| Uniprot ID |
Q13303 |
| Protein Name |
Voltage-gated potassium channel subunit beta-2 |
| Publications |
Metabolic regulation of Kv channels and cardiac repolarization by Kvβ2 subunits. J Mol Cell Cardiol. 137, 93-106 (2019). 31639389 |
| Sample Type Confirmation |
KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_003627 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003636 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
KCNAB2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-KCNAB2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Mouse Brain
 | Sample Type: P48 Mouse
Dilution: 1:2000 tested with brain slices in Immunohistochemistry |
|
| Image 3 | Human kidney
 | Human kidney |
|
| Image 4 | Human Jurkat
 | WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateKCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
