| Product Number |
ARP37665_T100 |
| Product Page |
www.avivasysbio.com/gpc3-antibody-middle-region-arp37665-t100.html |
| Name |
GPC3 Antibody - middle region (ARP37665_T100) |
| Protein Size (# AA) |
580 amino acids |
| Molecular Weight |
66 kDa |
| NCBI Gene Id |
2719 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Glypican 3 |
| Description |
|
| Alias Symbols |
SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Boily,G., et al., (2004) Br. J. Cancer 90 (8), 1606-1611 |
| Description of Target |
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome. |
| Protein Interactions |
UBC; WNT3A; WNT7B; IGF2; FGF2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-GPC3 (ARP37665_T100) antibody |
| Blocking Peptide |
For anti-GPC3 (ARP37665_T100) antibody is Catalog # AAP37665 (Previous Catalog # AAPP08963) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GPC3 |
| Uniprot ID |
P51654 |
| Protein Name |
Glypican-3 |
| Publications |
Bhave, V. S. et al. Regulation of liver growth by glypican 3, CD81, hedgehog, and Hhex. Am. J. Pathol. 183, 153-9 (2013). 23665349
Plasmodium parasite as an effective hepatocellular carcinoma antigen glypican-3 delivery vector. Oncotarget. 8, 24785-24796 (2017). 28445973 |
| Protein Accession # |
NP_004475 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004484 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GPC3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Adult Placenta
 | Host: Rabbit
Target Name: GPC3
Sample Tissue: Human Adult Placenta
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human Placenta
 | Rabbit Anti-GPC3 antibody
Catalog Number: ARP37665_T100
Paraffin Embedded Tissue: Human Placenta cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
