Product Number |
ARP37659_P050 |
Product Page |
www.avivasysbio.com/pdlim1-antibody-middle-region-arp37659-p050.html |
Name |
PDLIM1 Antibody - middle region (ARP37659_P050) |
Protein Size (# AA) |
327 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
54132 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
PDZ and LIM domain protein 1 |
Alias Symbols |
CLP, mCli, CLP36, Clim1, mClim1 |
Peptide Sequence |
Synthetic peptide located within the following region: ISNFNNAVESKTSASGKEANSRPLVQPHPSGSLIIDKESEVYKMLQEKQE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PDLIM1 (ARP37659_P050) antibody |
Blocking Peptide |
For anti-PDLIM1 (ARP37659_P050) antibody is Catalog # AAP37659 (Previous Catalog # AAPP09960) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse PDLIM1
|
Uniprot ID |
O70400 |
Protein Accession # |
NP_058557.2 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_016861.4 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
PDLIM1 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 86% |
Image 1 | Mouse Liver
| WB Suggested Anti-Pdlim1 Antibody Titration: 0.2-1 ug/ml Positive Control: Mouse Liver |
|
|