L3mbtl Antibody - middle region (ARP37652_P050)

Data Sheet
 
Product Number ARP37652_P050
Product Page www.avivasysbio.com/l3mbtl-antibody-middle-region-arp37652-p050.html
Name L3mbtl Antibody - middle region (ARP37652_P050)
Protein Size (# AA) 826 amino acids
Molecular Weight 91kDa
NCBI Gene Id 241764
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name L(3)mbt-like (Drosophila)
Alias Symbols L3MBT, L3mbtl, mKIAA0681, C630004G01
Peptide Sequence Synthetic peptide located within the following region: LKPMKKRKHKEYQSPSEESEPEAVKQGEGKDAEREPTPSTPENEEWSRSQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-L3mbtl1 (ARP37652_P050) antibody
Blocking Peptide For anti-L3mbtl1 (ARP37652_P050) antibody is Catalog # AAP37652 (Previous Catalog # AAPP09490)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human L3mbtl
Uniprot ID A2A5N8
Protein Name Lethal(3)malignant brain tumor-like protein 1
Protein Accession # XP_900202
Purification Affinity Purified
Nucleotide Accession # XM_895109
Tested Species Reactivity Mouse
Gene Symbol L3mbtl1
Predicted Species Reactivity Mouse
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%
Image 1
Mouse Small Intestine
WB Suggested Anti-L3mbtl Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com