Product Number |
ARP37652_P050 |
Product Page |
www.avivasysbio.com/l3mbtl-antibody-middle-region-arp37652-p050.html |
Name |
L3mbtl Antibody - middle region (ARP37652_P050) |
Protein Size (# AA) |
826 amino acids |
Molecular Weight |
91kDa |
NCBI Gene Id |
241764 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
L(3)mbt-like (Drosophila) |
Alias Symbols |
L3MBT, L3mbtl, mKIAA0681, C630004G01 |
Peptide Sequence |
Synthetic peptide located within the following region: LKPMKKRKHKEYQSPSEESEPEAVKQGEGKDAEREPTPSTPENEEWSRSQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-L3mbtl1 (ARP37652_P050) antibody |
Blocking Peptide |
For anti-L3mbtl1 (ARP37652_P050) antibody is Catalog # AAP37652 (Previous Catalog # AAPP09490) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human L3mbtl |
Uniprot ID |
A2A5N8 |
Protein Name |
Lethal(3)malignant brain tumor-like protein 1 |
Protein Accession # |
XP_900202 |
Purification |
Affinity Purified |
Nucleotide Accession # |
XM_895109 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
L3mbtl1 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
Image 1 | Mouse Small Intestine
| WB Suggested Anti-L3mbtl Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Mouse Small Intestine |
|
|