Product Number |
ARP37640_P050 |
Product Page |
www.avivasysbio.com/fam172a-antibody-n-terminal-region-arp37640-p050.html |
Name |
Fam172a Antibody - N-terminal region (ARP37640_P050) |
Protein Size (# AA) |
438 amino acids |
Molecular Weight |
48kDa |
NCBI Gene Id |
68675 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Family with sequence similarity 172, member A |
Alias Symbols |
pEN, 53-E6, pEN87, AF064782, 1110033M05Rik, 2610318O14Rik, 9430037D06Rik |
Peptide Sequence |
Synthetic peptide located within the following region: MTFKFPADPEVQSNLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The amino acid sequence of 1110033M05Rik is derived from an annotated genomic sequence (NT_039589) using gene prediction method: GNOMON, supported by mRNA and EST evidence. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Fam172a (ARP37640_P050) antibody |
Blocking Peptide |
For anti-Fam172a (ARP37640_P050) antibody is Catalog # AAP37640 (Previous Catalog # AAPP09487) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse 1110033M05RIK |
Uniprot ID |
Q3TNH5 |
Protein Accession # |
XP_193728 |
Purification |
Affinity Purified |
Nucleotide Accession # |
XM_193728 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Fam172a |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-Fam172a Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: NIH/3T3 cell lysate |
|
|