ZHX2 Antibody - C-terminal region (ARP37629_T100)

• Product Number: ARP37629_T100
• Name: ZHX2 Antibody - C-terminal region (ARP37629_T100)
• Protein Size (# AA): 836 amino acids
• Molecular Weight: 92kDa
• NCBI Gene Id: 387609
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc fingers and homeoboxes 2
• Alias Symbols: R, Af, Afr, Raf, Afr1, Afr-1, mKIAA0854
• Peptide Sequence: Synthetic peptide located within the following region: SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Perincheri,S., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (2), 396-401
• Description of Target: ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only indirectly, e.g., by regulating the synthesis of a hormone that controls AFP synthesis.
• Protein Interactions: Pxn; Kras; Hras;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZHX2 (ARP37629_T100) antibody is Catalog # AAP37629 (Previous Catalog # AAPP09481)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse ZHX2
• Uniprot ID: Q8C0C0
• Protein Name: Zinc fingers and homeoboxes protein 2
• Protein Accession #: NP_955520
• Purification: Protein A purified
• Nucleotide Accession #: NM_199449
• Tested Species Reactivity: Mouse
• Gene Symbol: ZHX2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 79%; Human: 79%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%
• Image 1: Mouse SP2/0
  
  WB Suggested Anti-ZHX2 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:62500
  Positive Control: SP2/0 cell lysate