| Product Number |
ARP37619_T100 |
| Product Page |
www.avivasysbio.com/pou2f1-antibody-c-terminal-region-arp37619-t100.html |
| Name |
POU2F1 Antibody - C-terminal region (ARP37619_T100) |
| Protein Size (# AA) |
522 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
18986 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
POU domain, class 2, transcription factor 1 |
| Alias Symbols |
Oct, Otf, Oct-, Oct1, Otf-, Otf1, NF-A1, Oct-1, Otf-1, 2810482H01Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: VTSSTATTLTVNPVLPLTSAAVTNLSLTGKQQPAYRLVSTVPVRFLWRTA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tantin,D., et al., (2005) Cancer Res. 65 (23), 10750-10758 |
| Description of Target |
POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region. |
| Protein Interactions |
Nf1; Brca1; Atf2; Tle4; Msx1; Aes; Prdm5; Polr1a; Pou2f1; Irf9; Hoxc4; Hoxb8; Hoxa9; Hoxa6; Nr3c1; Ar; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-POU2F1 (ARP37619_T100) antibody |
| Blocking Peptide |
For anti-POU2F1 (ARP37619_T100) antibody is Catalog # AAP37619 (Previous Catalog # AAPP09473) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse POU2F1 |
| Uniprot ID |
P25425-10 |
| Protein Name |
POU domain, class 2, transcription factor 1 |
| Publications |
Gupta, S. et al. Human organic cation transporter 1 is expressed in lymphoma cells and increases susceptibility to irinotecan and paclitaxel. J. Pharmacol. Exp. Ther. 341, 16-23 (2012). 22202118 |
| Protein Accession # |
NP_945150 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_198932 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
POU2F1 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-POU2F1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: SP2/0 cell lysate |
|
