| Product Number |
ARP37601_T100 |
| Product Page |
www.avivasysbio.com/homez-antibody-n-terminal-region-arp37601-t100.html |
| Name |
HOMEZ Antibody - N-terminal region (ARP37601_T100) |
| Protein Size (# AA) |
518 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
239099 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Homeodomain leucine zipper-encoding gene |
| Alias Symbols |
mKIAA1443 |
| Peptide Sequence |
Synthetic peptide located within the following region: LSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPLMMGSRTFSHQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bayarsaihan,D., et al., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (18), 10358-10363 |
| Description of Target |
Homez and members of ZHX family of zinc finger homeodomain factors are delineated as a subset within the superfamily of homeobox-containing proteins. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOMEZ (ARP37601_T100) antibody |
| Blocking Peptide |
For anti-HOMEZ (ARP37601_T100) antibody is Catalog # AAP37601 (Previous Catalog # AAPP09844) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse HOMEZ |
| Uniprot ID |
Q80W88 |
| Protein Name |
Homeobox and leucine zipper protein Homez |
| Protein Accession # |
NP_898997 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_183174 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
HOMEZ |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 85% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-HOMEZ Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate |
|
|
