Product Number |
ARP37600_T100 |
Product Page |
www.avivasysbio.com/tppp-antibody-c-terminal-region-arp37600-t100.html |
Name |
Tppp Antibody - C-terminal region (ARP37600_T100) |
Protein Size (# AA) |
218 amino acids |
Molecular Weight |
24kDa |
NCBI Gene Id |
72948 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Tubulin polymerization promoting protein |
Alias Symbols |
AI849835, TPPP/p25, 2900041A09Rik |
Peptide Sequence |
Synthetic peptide located within the following region: KAVSSPTVSRLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tirian,L., et al., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (24), 13976-13981 |
Description of Target |
This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome. |
Protein Interactions |
Invs; SNCA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Tppp (ARP37600_T100) antibody |
Blocking Peptide |
For anti-Tppp (ARP37600_T100) antibody is Catalog # AAP37600 (Previous Catalog # AAPP09692) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse 2900041A09RIK |
Uniprot ID |
Q7TQD2 |
Protein Name |
Tubulin polymerization-promoting protein |
Protein Accession # |
NP_878259 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_182839 |
Tested Species Reactivity |
Human |
Gene Symbol |
Tppp |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Frontal Cortex
| WB Suggested Anti-Tppp Antibody Titration: 0.625ug/ml ELISA Titer: 1:1562500 Positive Control: Human Frontal cortex |
|