website statistics
Product Datasheet: ARP37599_T100 - Tppp antibody - C-terminal region (ARP37599_T100) - Aviva Systems Biology
 
Tppp antibody - C-terminal region (ARP37599_T100)
Data Sheet
 
Product Number ARP37599_T100
Product Page www.avivasysbio.com/tppp-antibody-c-terminal-region-arp37599-t100.html
Product Name Tppp antibody - C-terminal region (ARP37599_T100)
Size 100 ul
Gene Symbol Tppp
Alias Symbols AI849835, 2900041A09Rik
Protein Size (# AA) 218 amino acids
Molecular Weight 24kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 72948
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Tubulin polymerization promoting protein
Description This is a rabbit polyclonal antibody against 2900041A09RIK. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ
Target Reference Tirian,L., et al., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (24), 13976-13981
Description of Target This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Protein Interactions Invs; SNCA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-Tppp (ARP37599_T100) antibody is Catalog # AAP37599 (Previous Catalog # AAPP09691)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Complete computational species homology data Anti-Tppp (ARP37599_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Tppp.
Swissprot Id Q7TQD2
Protein Name Tubulin polymerization-promoting protein
Protein Accession # NP_878259
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Tppp.
Nucleotide Accession # NM_182839
Replacement Item This antibody may replace item sc-134103 from Santa Cruz Biotechnology.
Conjugation Options

ARP37599_T100-FITC Conjugated

ARP37599_T100-HRP Conjugated

ARP37599_T100-Biotin Conjugated

CB Replacement sc-134103; sc-82065; sc-98687
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Brain
WB Suggested Anti-Tppp Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com