E2F7 Antibody - N-terminal region (ARP37584_T100)

Data Sheet
 
Product Number ARP37584_T100
Product Page www.avivasysbio.com/e2f7-antibody-n-terminal-region-arp37584-t100.html
Name E2F7 Antibody - N-terminal region (ARP37584_T100)
Protein Size (# AA) 904 amino acids
Molecular Weight 100 kDa
NCBI Gene Id 52679
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name E2F transcription factor 7
Alias Symbols E2F-7, D10Ertd739, D10Ertd739e, A630014C11Rik
Peptide Sequence Synthetic peptide located within the following region: LFRPIENKEDAFVNSLQLDVAGDGAVDEYEKQRPSRKQKSLGLLCQKFLA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference de Bruin,A., et al., (2003) J. Biol. Chem. 278 (43), 42041-42049
Description of Target E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-E2F7 (ARP37584_T100) antibody
Blocking Peptide For anti-E2F7 (ARP37584_T100) antibody is Catalog # AAP37584 (Previous Catalog # AAPP09843)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2F7
Uniprot ID Q6S7F2
Protein Name Transcription factor E2F7
Protein Accession # NP_848724
Purification Protein A purified
Nucleotide Accession # NM_178609
Tested Species Reactivity Mouse
Gene Symbol E2F7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Image 1
Mouse SP2/0
WB Suggested Anti-E2F7 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com