Product Number |
ARP37584_T100 |
Product Page |
www.avivasysbio.com/e2f7-antibody-n-terminal-region-arp37584-t100.html |
Name |
E2F7 Antibody - N-terminal region (ARP37584_T100) |
Protein Size (# AA) |
904 amino acids |
Molecular Weight |
100 kDa |
NCBI Gene Id |
52679 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
E2F transcription factor 7 |
Alias Symbols |
E2F-7, D10Ertd739, D10Ertd739e, A630014C11Rik |
Peptide Sequence |
Synthetic peptide located within the following region: LFRPIENKEDAFVNSLQLDVAGDGAVDEYEKQRPSRKQKSLGLLCQKFLA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
de Bruin,A., et al., (2003) J. Biol. Chem. 278 (43), 42041-42049 |
Description of Target |
E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-E2F7 (ARP37584_T100) antibody |
Blocking Peptide |
For anti-E2F7 (ARP37584_T100) antibody is Catalog # AAP37584 (Previous Catalog # AAPP09843) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2F7 |
Uniprot ID |
Q6S7F2 |
Protein Name |
Transcription factor E2F7 |
Protein Accession # |
NP_848724 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_178609 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
E2F7 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 93% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-E2F7 Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: SP2/0 cell lysate |
|
|