Product Number |
ARP37562_P050 |
Product Page |
www.avivasysbio.com/a830053o21rik-antibody-middle-region-arp37562-p050.html |
Name |
A830053O21Rik Antibody - middle region (ARP37562_P050) |
Protein Size (# AA) |
168 amino acids |
Molecular Weight |
18kDa |
NCBI Gene Id |
320522 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Basic helix-loop-helix family, member a9 |
Alias Symbols |
Fin, Fingerin, A830053O21Rik |
Peptide Sequence |
Synthetic peptide located within the following region: RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Bhlha9 (ARP37562_P050) antibody |
Blocking Peptide |
For anti-Bhlha9 (ARP37562_P050) antibody is Catalog # AAP37562 (Previous Catalog # AAPP09668) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse A830053O21Rik |
Uniprot ID |
Q5RJB0 |
Protein Name |
Class A basic helix-loop-helix protein 9 |
Protein Accession # |
NP_796156 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_177182 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Bhlha9 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
Image 1 | Mouse Brain
| WB Suggested Anti-A830053O21Rik Antibody Titration: 0.2-1 ug/ml Positive Control: Mouse Brain |
|
|