| Product Number |
ARP37559_T100 |
| Product Page |
www.avivasysbio.com/rbm35b-antibody-n-terminal-region-arp37559-t100.html |
| Name |
RBM35B Antibody - N-terminal region (ARP37559_T100) |
| Protein Size (# AA) |
717 amino acids |
| Molecular Weight |
79kDa |
| NCBI Gene Id |
77411 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Epithelial splicing regulatory protein 2 |
| Alias Symbols |
Rbm35, Rbm35b, 9530027K23Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF
|
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
McKee,A.E., (er) BMC Dev. Biol. 5, 14 (2005) |
| Description of Target |
The function remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Esrp2 (ARP37559_T100) antibody |
| Blocking Peptide |
For anti-Esrp2 (ARP37559_T100) antibody is Catalog # AAP37559 (Previous Catalog # AAPS06112) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RBM35B |
| Uniprot ID |
Q8K0G8 |
| Protein Name |
Epithelial splicing regulatory protein 2 |
| Protein Accession # |
NP_789808 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_176838 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Esrp2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-RBM35B Antibody Titration: 2.5ug/ml
Positive Control: NIH/3T3 cell lysate |
|
|
