Product Number |
ARP37557_P050 |
Product Page |
www.avivasysbio.com/dmrta1-antibody-n-terminal-region-arp37557-p050.html |
Name |
DMRTA1 Antibody - N-terminal region (ARP37557_P050) |
Protein Size (# AA) |
490 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
242523 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Doublesex and mab-3 related transcription factor like family A1 |
Alias Symbols |
Dmrt, Dmrt4 |
Peptide Sequence |
Synthetic peptide located within the following region: LRRQQAQEESEARGLHRLLYQGSSGSGAQASGGSGRTESPQVLNNPMAVA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kim,S., (2003) Gene Expr. Patterns 3 (1), 77-82 |
Description of Target |
Dmrta1 is a DM domain containing transcription factors (DM = dsx and mab-3) and may be involved in sexual development |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DMRTA1 (ARP37557_P050) antibody |
Blocking Peptide |
For anti-DMRTA1 (ARP37557_P050) antibody is Catalog # AAP37557 (Previous Catalog # AAPP09663) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse DMRTA1 |
Uniprot ID |
Q8CFG4 |
Protein Name |
Doublesex- and mab-3-related transcription factor A1 |
Protein Accession # |
NP_783578 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_175647 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
DMRTA1 |
Predicted Species Reactivity |
Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 92% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-DMRTA1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: NIH/3T3 cell lysate |
|
|