DMRTA1 Antibody - N-terminal region (ARP37557_P050)

Data Sheet
 
Product Number ARP37557_P050
Product Page www.avivasysbio.com/dmrta1-antibody-n-terminal-region-arp37557-p050.html
Name DMRTA1 Antibody - N-terminal region (ARP37557_P050)
Protein Size (# AA) 490 amino acids
Molecular Weight 54kDa
NCBI Gene Id 242523
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Doublesex and mab-3 related transcription factor like family A1
Alias Symbols Dmrt, Dmrt4
Peptide Sequence Synthetic peptide located within the following region: LRRQQAQEESEARGLHRLLYQGSSGSGAQASGGSGRTESPQVLNNPMAVA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kim,S., (2003) Gene Expr. Patterns 3 (1), 77-82
Description of Target Dmrta1 is a DM domain containing transcription factors (DM = dsx and mab-3) and may be involved in sexual development
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DMRTA1 (ARP37557_P050) antibody
Blocking Peptide For anti-DMRTA1 (ARP37557_P050) antibody is Catalog # AAP37557 (Previous Catalog # AAPP09663)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse DMRTA1
Uniprot ID Q8CFG4
Protein Name Doublesex- and mab-3-related transcription factor A1
Protein Accession # NP_783578
Purification Affinity Purified
Nucleotide Accession # NM_175647
Tested Species Reactivity Mouse
Gene Symbol DMRTA1
Predicted Species Reactivity Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%; Rat: 92%
Image 1
Mouse NIH-3T3
WB Suggested Anti-DMRTA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com