| Product Number |
ARP37554_P050 |
| Product Page |
www.avivasysbio.com/zbtb38-antibody-n-terminal-region-arp37554-p050.html |
| Name |
ZBTB38 Antibody - N-terminal region (ARP37554_P050) |
| Protein Size (# AA) |
546 amino acids |
| Molecular Weight |
60kDa |
| NCBI Gene Id |
245007 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 38 |
| Alias Symbols |
CIB, CIBZ, A930014K01Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sasai,N., et al., (2005) Genes Cells 10 (9), 871-885 |
| Description of Target |
ZBTB38 physically associates with CtBP via a conserved CtBP binding motif, PLDLR. When heterologously targeted to DNA, it represses transcription via two independent repression domains, an N-terminal BTB domain and a PLDLR motif-containing RD2 region, in a histone deacetylase-independent and -dependent manner, respectively |
| Protein Interactions |
CBFA2T3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB38 (ARP37554_P050) antibody |
| Blocking Peptide |
For anti-ZBTB38 (ARP37554_P050) antibody is Catalog # AAP37554 (Previous Catalog # AAPP09660) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8BIL1 |
| Protein Name |
Putative uncharacterized protein EMBL BAC31937.1 |
| Protein Accession # |
NP_780746 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_175537 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
ZBTB38 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rat: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-ZBTB38 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate |
|
|
