| Product Number |
ARP37543_P050 |
| Product Page |
www.avivasysbio.com/prox2-antibody-n-terminal-region-arp37543-p050.html |
| Name |
Prox2 Antibody - N-terminal region (ARP37543_P050) |
| Protein Size (# AA) |
593 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
73422 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Prospero homeobox 2 |
| Alias Symbols |
1700058C01Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: MDPPAAVLLPPQSRTCTHLAEETCMDQERSPATAEAGRDSFPSGQLPSSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Prox2 is a transcription regulator.Prox2 does not seem to be essential for embryonic development and postnatal survival. |
| Protein Interactions |
GSK3B; GSK3A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Prox2 (ARP37543_P050) antibody |
| Blocking Peptide |
For anti-Prox2 (ARP37543_P050) antibody is Catalog # AAP37543 (Previous Catalog # AAPP09649) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the n terminal region of mouse Prox2 |
| Uniprot ID |
Q8BII1 |
| Protein Name |
Prospero homeobox protein 2 |
| Protein Accession # |
NP_780407 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_175198 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Prox2 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 79% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Prox2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Brain |
|
|
