Product Number |
ARP37531_T100 |
Product Page |
www.avivasysbio.com/csnk1g1-antibody-middle-region-arp37531-t100.html |
Name |
CSNK1G1 Antibody - middle region (ARP37531_T100) |
Protein Size (# AA) |
459 amino acids |
Molecular Weight |
50kDa |
NCBI Gene Id |
214897 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Casein kinase 1, gamma 1 |
Alias Symbols |
9130020E21Rik |
Peptide Sequence |
Synthetic peptide located within the following region: CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chergui,K., et al., (2005) J. Neurosci. 25 (28), 6601-6609 |
Description of Target |
CSNK1g1 is involved in regulation of fast synaptic transmission mediated by glutamate, the major excitatory neurotransmitter in the brain. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CSNK1G1 (ARP37531_T100) antibody |
Blocking Peptide |
For anti-CSNK1G1 (ARP37531_T100) antibody is Catalog # AAP37531 (Previous Catalog # AAPP09963) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse CSNK1G1 |
Uniprot ID |
Q8BTH8 |
Protein Name |
Casein kinase I isoform gamma-1 |
Protein Accession # |
NP_775277 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_173185 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
CSNK1G1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 85% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-CSNK1G1 Antibody Titration: 5.0ug/ml ELISA Titer: 1:312500 Positive Control: SP2/0 cell lysate |
|
|