CSNK1G1 Antibody - middle region (ARP37531_T100)

Data Sheet
 
Product Number ARP37531_T100
Product Page www.avivasysbio.com/csnk1g1-antibody-middle-region-arp37531-t100.html
Name CSNK1G1 Antibody - middle region (ARP37531_T100)
Protein Size (# AA) 459 amino acids
Molecular Weight 50kDa
NCBI Gene Id 214897
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Casein kinase 1, gamma 1
Alias Symbols 9130020E21Rik
Peptide Sequence Synthetic peptide located within the following region: CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chergui,K., et al., (2005) J. Neurosci. 25 (28), 6601-6609
Description of Target CSNK1g1 is involved in regulation of fast synaptic transmission mediated by glutamate, the major excitatory neurotransmitter in the brain.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CSNK1G1 (ARP37531_T100) antibody
Blocking Peptide For anti-CSNK1G1 (ARP37531_T100) antibody is Catalog # AAP37531 (Previous Catalog # AAPP09963)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse CSNK1G1
Uniprot ID Q8BTH8
Protein Name Casein kinase I isoform gamma-1
Protein Accession # NP_775277
Purification Protein A purified
Nucleotide Accession # NM_173185
Tested Species Reactivity Mouse
Gene Symbol CSNK1G1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 85%
Image 1
Mouse SP2/0
WB Suggested Anti-CSNK1G1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com