Product Number |
ARP37525_P050 |
Product Page |
www.avivasysbio.com/cbfa2t2h-antibody-middle-region-arp37525-p050.html |
Name |
CBFA2T2H Antibody - middle region (ARP37525_P050) |
Protein Size (# AA) |
594 amino acids |
Molecular Weight |
65kDa |
NCBI Gene Id |
12396 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human) |
Alias Symbols |
MTGR, MTGR1, Cbfa2t2h, A430091M07, C330013D05Rik |
Peptide Sequence |
Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yoshikawa,T., et al., (er) Gene Expr. Patterns (2005) In press |
Description of Target |
Mouse Cbfa2t2h associates with mSin3A, N-CoR, and histone deacetylase 3 and that when tethered to DNA, it acts as a transcriptional corepressor. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Cbfa2t2 (ARP37525_P050) antibody |
Blocking Peptide |
For anti-Cbfa2t2 (ARP37525_P050) antibody is Catalog # AAP37525 (Previous Catalog # AAPP09631) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse CBFA2T2H |
Uniprot ID |
Q6P288 |
Protein Name |
Protein CBFA2T2 |
Protein Accession # |
NP_766448 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_172860 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Cbfa2t2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-CBFA2T2H Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: NIH/3T3 cell lysate |
|
|