| Product Number |
ARP37517_P050 |
| Product Page |
www.avivasysbio.com/lbxcor1-antibody-middle-region-arp37517-p050.html |
| Name |
Lbxcor1 Antibody - middle region (ARP37517_P050) |
| Protein Size (# AA) |
964 amino acids |
| Molecular Weight |
100kDa |
| NCBI Gene Id |
207667 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SKI family transcriptional corepressor 1 |
| Alias Symbols |
Co, Lbxc, Corl1, Lbxcor1, AV273001, C230094B15Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Lbxcor1 inhibits BMP signaling. Lbxcor1 acts as a transcriptional corepressor of LBX1. |
| Protein Interactions |
Hdac1; Zbtb16; Tle1; Pcbp2; Lbx1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Skor1 (ARP37517_P050) antibody |
| Blocking Peptide |
For anti-Skor1 (ARP37517_P050) antibody is Catalog # AAP37517 (Previous Catalog # AAPP09623) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Lbxcor1 |
| Uniprot ID |
Q8BX46 |
| Protein Name |
SKI family transcriptional corepressor 1 |
| Protein Accession # |
NP_766034 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172446 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Skor1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Lbxcor1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Kidney |
|
|
