Product Number |
ARP37512_T100 |
Product Page |
www.avivasysbio.com/a830039h10rik-antibody-c-terminal-region-arp37512-t100.html |
Name |
A830039H10RIK Antibody - C-terminal region (ARP37512_T100) |
Protein Size (# AA) |
517 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
209707 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Ligand dependent nuclear receptor corepressor-like |
Alias Symbols |
Ml, Mlr1 |
Peptide Sequence |
Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Blackshaw,S., (2004) PLoS Biol. 2 (9), E247 |
Description of Target |
This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Lcorl (ARP37512_T100) antibody |
Blocking Peptide |
For anti-Lcorl (ARP37512_T100) antibody is Catalog # AAP37512 (Previous Catalog # AAPP09620) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
Q8CJG4 |
Protein Name |
Ligand-dependent nuclear receptor corepressor-like protein |
Protein Accession # |
NP_742165 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_172153 |
Tested Species Reactivity |
Human |
Gene Symbol |
Lcorl |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human Testis
| WB Suggested Anti-A830039H10RIK Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: Human Testis |
|
|