| Product Number |
ARP37505_P050 |
| Product Page |
www.avivasysbio.com/tgifx1-antibody-middle-region-arp37505-p050.html |
| Name |
TGIFX1 Antibody - middle region (ARP37505_P050) |
| Protein Size (# AA) |
231 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
245583 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TGFB-induced factor homeobox 2-like, X-linked 1 |
| Alias Symbols |
Tex1, Tgif2, Tgifx, Tgifx1, Tgif2lx |
| Peptide Sequence |
Synthetic peptide located within the following region: HSNPSEEVKAQFNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Jin,L., et al., (2005) Gene Expr. Patterns 5 (4), 457-462 |
| Description of Target |
The homeobox gene superfamily is highly conserved during evolution. These members act as transcription factors during several important developmental processes through their 60 amino acid homeodomains that recognize and bind to the regulatory region of their target genes. Tgifx1, the product of a novel testis homeobox gene, may play a crucial role during spermatogenesis. |
| Protein Interactions |
Ldb1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Tgif2lx1 (ARP37505_P050) antibody |
| Blocking Peptide |
For anti-Tgif2lx1 (ARP37505_P050) antibody is Catalog # AAP37505 (Previous Catalog # AAPP09834) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse TGIFX1 |
| Uniprot ID |
Q2NKH6 |
| Protein Name |
Tgif2lx protein EMBL AAI11834.1 |
| Protein Accession # |
NP_694749 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153109 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
Tgif2lx1 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
| Image 1 | Human Testis
 | WB Suggested Anti-TGIFX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Testis |
|
|
