| Product Number |
ARP37504_T100 |
| Product Page |
www.avivasysbio.com/mkl1-antibody-c-terminal-region-arp37504-t100.html |
| Name |
MKL1 Antibody - C-terminal region (ARP37504_T100) |
| Protein Size (# AA) |
964 amino acids |
| Molecular Weight |
106kDa |
| NCBI Gene Id |
223701 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
MKL (megakaryoblastic leukemia)/myocardin-like 1 |
| Description |
|
| Alias Symbols |
M, Bs, Mal, Mkl, AMKL, Bsac, MRTF, Mkl1, Mrtf-A |
| Peptide Sequence |
Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sasazuki,T., et al., (2002) J. Biol. Chem. 277 (32), 28853-28860 |
| Description of Target |
MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells |
| Protein Interactions |
Lhx2; SRF; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MKL1 (ARP37504_T100) antibody |
| Blocking Peptide |
For anti-MKL1 (ARP37504_T100) antibody is Catalog # AAP37504 (Previous Catalog # AAPP09616) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8K4J6 |
| Protein Name |
MKL/myocardin-like protein 1 |
| Publications |
Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. Cell Rep. 32, 108050 (2020). 32814053
Mechanism of irradiation-induced mammary cancer metastasis: A role for SAP-dependent Mkl1 signaling. Mol Oncol. 9, 1510-27 (2015). 25999144 |
| Protein Accession # |
NP_694629 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_153049 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
MKL1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%; Zebrafish: 75% |
| Image 1 | Mouse Spleen
 | Host: Rabbit
Target Name: MKL1
Sample Tissue: Mouse Spleen
Antibody Dilution: 1.0ug/ml |
|
