EBF4 Antibody - N-terminal region (ARP37502_T100)

• Product Number: ARP37502_T100
• Name: EBF4 Antibody - N-terminal region (ARP37502_T100)
• Protein Size (# AA): 541 amino acids
• Molecular Weight: 60kDa
• NCBI Gene Id: 228598
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Early B cell factor 4
• Alias Symbols: Ebf3, O/E-, O/E-4, Olf-1
• Peptide Sequence: Synthetic peptide located within the following region: YDRQGQPVEVERTAFIDFVEKDREPGTEKTNNGIHYRLRLVYNNGLRTEQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mella,S., et al., (2004) Gene Expr. Patterns 4 (5), 537-542
• Description of Target: EBF4 is a member of Olf-1/Ebf-like gene family. It is expressed in the neuronal and basal cell layers of olfactory epithelium and may interact with other O/E family members to regulate gene expression in the olfactory sensory neurons.
• Protein Interactions: Ebf3; Ebf1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-EBF4 (ARP37502_T100) antibody is Catalog # AAP37502 (Previous Catalog # AAPP09614)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EBF4
• Uniprot ID: Q8K4J2-4
• Protein Name: Transcription factor COE4
• Protein Accession #: NP_694538
• Purification: Protein A purified
• Nucleotide Accession #: NM_152993
• Tested Species Reactivity: Mouse
• Gene Symbol: EBF4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%; Zebrafish: 79%
• Image 1: Mouse SP2/0
  
  WB Suggested Anti-EBF4 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:312500
  Positive Control: SP2/0 cell lysate