Product Number |
ARP37494_T100 |
Product Page |
www.avivasysbio.com/obox6-antibody-middle-region-arp37494-t100.html |
Name |
OBOX6 Antibody - middle region (ARP37494_T100) |
Protein Size (# AA) |
305 amino acids |
Molecular Weight |
34kDa |
NCBI Gene Id |
252830 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Oocyte specific homeobox 6 |
Alias Symbols |
D17Ertd599, D17Ertd599e |
Peptide Sequence |
Synthetic peptide located within the following region: MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Rajkovic,A., et al., (2002) Genomics 79 (5), 711-717 |
Description of Target |
Obox6 belongs to the Obox family that represents a new family of tissue-specific homeobox genes preferentially expressed in gonads. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-OBOX6 (ARP37494_T100) antibody |
Blocking Peptide |
For anti-OBOX6 (ARP37494_T100) antibody is Catalog # AAP37494 (Previous Catalog # AAPP09610) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse OBOX6 |
Uniprot ID |
Q8VHG3 |
Protein Name |
OBOX6 EMBL AAL68805.1 |
Protein Accession # |
NP_663756 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_145710 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
OBOX6 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-OBOX6 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: SP2/0 cell lysate |
|
|