OBOX6 Antibody - middle region (ARP37494_T100)

Data Sheet
 
Product Number ARP37494_T100
Product Page www.avivasysbio.com/obox6-antibody-middle-region-arp37494-t100.html
Name OBOX6 Antibody - middle region (ARP37494_T100)
Protein Size (# AA) 305 amino acids
Molecular Weight 34kDa
NCBI Gene Id 252830
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Oocyte specific homeobox 6
Alias Symbols D17Ertd599, D17Ertd599e
Peptide Sequence Synthetic peptide located within the following region: MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rajkovic,A., et al., (2002) Genomics 79 (5), 711-717
Description of Target Obox6 belongs to the Obox family that represents a new family of tissue-specific homeobox genes preferentially expressed in gonads.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-OBOX6 (ARP37494_T100) antibody
Blocking Peptide For anti-OBOX6 (ARP37494_T100) antibody is Catalog # AAP37494 (Previous Catalog # AAPP09610)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse OBOX6
Uniprot ID Q8VHG3
Protein Name OBOX6 EMBL AAL68805.1
Protein Accession # NP_663756
Purification Protein A purified
Nucleotide Accession # NM_145710
Tested Species Reactivity Mouse
Gene Symbol OBOX6
Predicted Species Reactivity Mouse
Application WB
Predicted Homology Based on Immunogen Sequence Mouse: 100%
Image 1
Mouse SP2/0
WB Suggested Anti-OBOX6 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: SP2/0 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com