GATAD2A Antibody - N-terminal region (ARP37492_T100)

Data Sheet
 
Product Number ARP37492_T100
Product Page www.avivasysbio.com/gatad2a-antibody-n-terminal-region-arp37492-t100.html
Name GATAD2A Antibody - N-terminal region (ARP37492_T100)
Protein Size (# AA) 630 amino acids
Molecular Weight 69kDa
NCBI Gene Id 234366
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name GATA zinc finger domain containing 2A
Alias Symbols C80248, BC031407, 1110066C11Rik
Peptide Sequence Synthetic peptide located within the following region: MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ko,M.S., et al., (2000) Development 127 (8), 1737-1749
Description of Target GATAD2A's function is not determined.
Protein Interactions Nanog; L3mbtl2; Foxp3; Pou5f1; Sall4; Tfcp2l1; Esrrb; Sin3a;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GATAD2A (ARP37492_T100) antibody
Blocking Peptide For anti-GATAD2A (ARP37492_T100) antibody is Catalog # AAP37492 (Previous Catalog # AAPP09608)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse GATAD2A
Uniprot ID Q8CHY6
Protein Name Transcriptional repressor p66 alpha
Protein Accession # NP_663571
Purification Protein A purified
Nucleotide Accession # NM_145596
Tested Species Reactivity Mouse
Gene Symbol GATAD2A
Predicted Species Reactivity Human, Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Human: 91%; Mouse: 100%; Rat: 92%
Image 1
Mouse SP2/0
WB Suggested Anti-GATAD2A Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com