Product Number |
ARP37492_T100 |
Product Page |
www.avivasysbio.com/gatad2a-antibody-n-terminal-region-arp37492-t100.html |
Name |
GATAD2A Antibody - N-terminal region (ARP37492_T100) |
Protein Size (# AA) |
630 amino acids |
Molecular Weight |
69kDa |
NCBI Gene Id |
234366 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
GATA zinc finger domain containing 2A |
Alias Symbols |
C80248, BC031407, 1110066C11Rik |
Peptide Sequence |
Synthetic peptide located within the following region: MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ko,M.S., et al., (2000) Development 127 (8), 1737-1749 |
Description of Target |
GATAD2A's function is not determined. |
Protein Interactions |
Nanog; L3mbtl2; Foxp3; Pou5f1; Sall4; Tfcp2l1; Esrrb; Sin3a; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GATAD2A (ARP37492_T100) antibody |
Blocking Peptide |
For anti-GATAD2A (ARP37492_T100) antibody is Catalog # AAP37492 (Previous Catalog # AAPP09608) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse GATAD2A |
Uniprot ID |
Q8CHY6 |
Protein Name |
Transcriptional repressor p66 alpha |
Protein Accession # |
NP_663571 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_145596 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
GATAD2A |
Predicted Species Reactivity |
Human, Mouse, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 91%; Mouse: 100%; Rat: 92% |
Image 1 | Mouse SP2/0
| WB Suggested Anti-GATAD2A Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: SP2/0 cell lysate |
|
|