| Product Number |
ARP37474_P050 |
| Product Page |
www.avivasysbio.com/zfp192-antibody-middle-region-arp37474-p050.html |
| Name |
Zfp192 Antibody - middle region (ARP37474_P050) |
| Protein Size (# AA) |
588 amino acids |
| Molecular Weight |
67kDa |
| NCBI Gene Id |
93681 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 192 |
| Alias Symbols |
LD5-, LD5-1, Zfp19, Zfp192, 2510038J07Rik, D430019P06Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Zkscan8 (ARP37474_P050) antibody |
| Blocking Peptide |
For anti-Zkscan8 (ARP37474_P050) antibody is Catalog # AAP37474 (Previous Catalog # AAPP09593) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8BSL0 |
| Protein Name |
Protein Zfp192 Ensembl ENSMUSP00000040248 |
| Protein Accession # |
NP_631880 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_139141 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Zkscan8 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Horse: 77%; Human: 86%; Mouse: 100%; Pig: 93%; Rabbit: 83%; Rat: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-Zfp192 Antibody Titration: 0.2-1 ug/ml
Positive Control: SP2/0 cell lysate |
|
|
