| Product Number |
ARP37471_T100 |
| Product Page |
www.avivasysbio.com/nr5a1-antibody-c-terminal-region-arp37471-t100.html |
| Name |
NR5A1 Antibody - C-terminal region (ARP37471_T100) |
| Protein Size (# AA) |
462 amino acids |
| Molecular Weight |
51kDa |
| NCBI Gene Id |
26423 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Nuclear receptor subfamily 5, group A, member 1 |
| Alias Symbols |
E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1 |
| Peptide Sequence |
Synthetic peptide located within the following region: QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fatchiyah, et al., (2006) Biochem. Biophys. Res. Commun. 341 (4), 1036-1045 |
| Description of Target |
NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. |
| Protein Interactions |
Pitx1; Nfya; Pin1; Sumo1; Ubc; Egr1; Mir383; Ncoa1; Sumo2; Ppargc1a; Lhb; Tbx19; Sox9; Nr0b2; Nr0b1; Ncoa2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NR5A1 (ARP37471_T100) antibody |
| Blocking Peptide |
For anti-NR5A1 (ARP37471_T100) antibody is Catalog # AAP37471 (Previous Catalog # AAPP09590) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
P33242 |
| Protein Name |
Steroidogenic factor 1 |
| Protein Accession # |
NP_620639 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_139051 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NR5A1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
| Image 1 | Human Adrenal Gland
 | WB Suggested Anti-NR5A1 Antibody Titration: 0.3125ug/ml
ELISA Titer: 1:312500
Positive Control: Human Adrenal gland |
|
