| Product Number |
ARP37467_T100 |
| Product Page |
www.avivasysbio.com/ces6-antibody-middle-region-arp37467-t100.html |
| Name |
CES6 Antibody - middle region (ARP37467_T100) |
| Protein Size (# AA) |
558 amino acids |
| Molecular Weight |
61kDa |
| NCBI Gene Id |
102022 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Carboxylesterase 2A |
| Alias Symbols |
Ces, Ces6, AI266984, 9130231C15Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Stok,J.E., et al., (2004) J. Biol. Chem. 279 (28), 29863-29869 |
| Description of Target |
Mouse Ces6 is a member of carboxylesterases family. Carboxylesterases are enzymes that catalyze the hydrolysis of a wide range of ester-containing endogenous and xenobiotic compounds. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ces2a (ARP37467_T100) antibody |
| Blocking Peptide |
For anti-Ces2a (ARP37467_T100) antibody is Catalog # AAP37467 (Previous Catalog # AAPP09822) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q8QZR3 |
| Protein Name |
Carboxylesterase 6 EMBL AAH24491.1 |
| Protein Accession # |
NP_598721 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_133960 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Ces2a |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-CES6 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate |
|
|
