| Product Number |
ARP37435_T100 |
| Product Page |
www.avivasysbio.com/smarca1-antibody-n-terminal-region-arp37435-t100.html |
| Name |
SMARCA1 Antibody - N-terminal region (ARP37435_T100) |
| Protein Size (# AA) |
381 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
93761 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 |
| Alias Symbols |
Sn, Snf2l, 5730494M04Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Okazaki,Y., et al., (2002) Nature 420 (6915), 563-573 |
| Description of Target |
cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN. |
| Protein Interactions |
Eed; Ewsr1; Baz1a; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SMARCA1 (ARP37435_T100) antibody |
| Blocking Peptide |
For anti-SMARCA1 (ARP37435_T100) antibody is Catalog # AAP37435 (Previous Catalog # AAPP09810) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMARCA1 |
| Uniprot ID |
Q8BS67 |
| Protein Name |
Probable global transcription activator SNF2L1 Ensembl ENSMUSP00000135570 |
| Protein Accession # |
BAC28931 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_053123 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
SMARCA1 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
CHIP, WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 100% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-SMARCA1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: NIH/3T3 cell lysate |
| | Image 2 | HCT116
 | Chromatin Immunoprecipitation (ChIP) Using SMARCA1 antibody - N-terminal region (ARP37435_T100) and HCT116 Cells |
|
|
