| Product Number |
ARP37432_T100 |
| Product Page |
www.avivasysbio.com/tcf23-antibody-c-terminal-region-arp37432-t100.html |
| Name |
TCF23 Antibody - C-terminal region (ARP37432_T100) |
| Protein Size (# AA) |
209 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
69852 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Transcription factor 23 |
| Alias Symbols |
Ou, Out, bHLHa, bHLHa24, 2010002O16Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: PMRSRLYAGGLGCSDLDSTTAITTGQRCKDAELGSQDSVAAESLLTSPAF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tachibana,M., et al., (2003) Cytogenet. Cell Genet. 94 (1-2), 23-25 |
| Description of Target |
TCF23 belongs to the basic helix-loop-helix (bHLH) family are involved in various cell differentiation processes |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TCF23 (ARP37432_T100) antibody |
| Blocking Peptide |
For anti-TCF23 (ARP37432_T100) antibody is Catalog # AAP37432 (Previous Catalog # AAPP09809) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TCF23 |
| Uniprot ID |
Q9JLR5 |
| Protein Name |
Transcription factor 23 |
| Protein Accession # |
NP_444315 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_053085 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
TCF23 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-TCF23 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: SP2/0 cell lysate |
|
|
