| Product Number |
ARP37422_T100 |
| Product Page |
www.avivasysbio.com/actn2-antibody-c-terminal-region-arp37422-t100.html |
| Name |
ACTN2 Antibody - C-terminal region (ARP37422_T100) |
| Protein Size (# AA) |
894 amino acids |
| Molecular Weight |
98kDa |
| NCBI Gene Id |
11472 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Actinin alpha 2 |
| Alias Symbols |
1110008F24Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hirschy,A., et al., (2006) Dev. Biol. 289 (2), 430-441 |
| Description of Target |
The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function. |
| Protein Interactions |
Grip1; Ar; Grin2b; Grin1; Ldb3; ADORA2A; Raver1; Myoz1; Myoz3; Myoz2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ACTN2 (ARP37422_T100) antibody |
| Blocking Peptide |
For anti-ACTN2 (ARP37422_T100) antibody is Catalog # AAP37422 (Previous Catalog # AAPP09577) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q9JI91 |
| Protein Name |
Alpha-actinin-2 |
| Protein Accession # |
NP_150371 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_033268 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ACTN2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 83% |
| Image 1 | Human Muscle
 | WB Suggested Anti-ACTN2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle |
|
|
