| Product Number |
ARP37406_P050 |
| Product Page |
www.avivasysbio.com/pbx4-antibody-n-terminal-region-arp37406-p050.html |
| Name |
Pbx4 Antibody - N-terminal region (ARP37406_P050) |
| Protein Size (# AA) |
378 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
80720 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Pre B cell leukemia homeobox 4 |
| Alias Symbols |
AI429113, AW045266, 2410015M21Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: MAAPLRPVPPQPAPRRLPTTAPLGHDTSDVLQQIMAITDQSLDEAQARKH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Pknox2; Jdp2; Ssbp4; Tcf3; Polr2j; Nfe2; Meis3; Meis2; Meis1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Pbx4 (ARP37406_P050) antibody |
| Blocking Peptide |
For anti-Pbx4 (ARP37406_P050) antibody is Catalog # AAP37406 (Previous Catalog # AAPP09943) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q99NE9 |
| Protein Name |
Pre-B-cell leukemia transcription factor 4 |
| Protein Accession # |
NP_001020125 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001024954 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Pbx4 |
| Predicted Species Reactivity |
Mouse, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Mouse: 100%; Rat: 92% |
| Image 1 | Mouse Small Intestine
 | WB Suggested Anti-Pbx4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Small Intestine |
|
|
